LOCUS aflM_aflN_IC1596 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1596. ACCESSION aflM_aflN_IC1596 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1596" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1597 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1597. ACCESSION aflM_aflN_IC1597 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1597" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1598 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1598. ACCESSION aflM_aflN_IC1598 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1598" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1599 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1599. ACCESSION aflM_aflN_IC1599 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1599" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1600 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1600. ACCESSION aflM_aflN_IC1600 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1600" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1601 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1601. ACCESSION aflM_aflN_IC1601 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1601" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1602 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1602. ACCESSION aflM_aflN_IC1602 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1602" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1603 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1603. ACCESSION aflM_aflN_IC1603 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1603" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1604 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1604. ACCESSION aflM_aflN_IC1604 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1604" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1605 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1605. ACCESSION aflM_aflN_IC1605 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1605" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1606 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1606. ACCESSION aflM_aflN_IC1606 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1606" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1607 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1607. ACCESSION aflM_aflN_IC1607 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1607" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1608 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1608. ACCESSION aflM_aflN_IC1608 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1608" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1610 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1610. ACCESSION aflM_aflN_IC1610 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1610" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1611 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1611. ACCESSION aflM_aflN_IC1611 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1611" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1612 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1612. ACCESSION aflM_aflN_IC1612 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1612" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1613 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1613. ACCESSION aflM_aflN_IC1613 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1613" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1614 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1614. ACCESSION aflM_aflN_IC1614 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1614" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1615 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1615. ACCESSION aflM_aflN_IC1615 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1615" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1616 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1616. ACCESSION aflM_aflN_IC1616 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1616" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1617 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1617. ACCESSION aflM_aflN_IC1617 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1617" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1618 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1618. ACCESSION aflM_aflN_IC1618 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1618" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1619 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1619. ACCESSION aflM_aflN_IC1619 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1619" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1620 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1620. ACCESSION aflM_aflN_IC1620 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1620" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1621 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1621. ACCESSION aflM_aflN_IC1621 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1621" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1622 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1622. ACCESSION aflM_aflN_IC1622 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1622" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSXFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 77 a 75 c 66 g 83 t 1 others ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aantcggagg 301 gt // LOCUS aflM_aflN_IC1623 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1623. ACCESSION aflM_aflN_IC1623 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1623" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1624 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1624. ACCESSION aflM_aflN_IC1624 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1624" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1625 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1625. ACCESSION aflM_aflN_IC1625 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1625" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1626 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1626. ACCESSION aflM_aflN_IC1626 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1626" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1627 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1627. ACCESSION aflM_aflN_IC1627 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1627" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1628 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1628. ACCESSION aflM_aflN_IC1628 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1628" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1629 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1629. ACCESSION aflM_aflN_IC1629 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1629" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1630 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1630. ACCESSION aflM_aflN_IC1630 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1630" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1631 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1631. ACCESSION aflM_aflN_IC1631 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1631" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PTDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 77 a 80 c 61 g 84 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggtgg 301 gc // LOCUS aflM_aflN_IC1632 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1632. ACCESSION aflM_aflN_IC1632 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1632" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1633 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1633. ACCESSION aflM_aflN_IC1633 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1633" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1634 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1634. ACCESSION aflM_aflN_IC1634 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1634" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1635 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1635. ACCESSION aflM_aflN_IC1635 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1635" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1636 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1636. ACCESSION aflM_aflN_IC1636 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1636" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1637 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1637. ACCESSION aflM_aflN_IC1637 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1637" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1638 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1638. ACCESSION aflM_aflN_IC1638 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1638" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1639 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1639. ACCESSION aflM_aflN_IC1639 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1639" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1640 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1640. ACCESSION aflM_aflN_IC1640 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1640" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1641 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1641. ACCESSION aflM_aflN_IC1641 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1641" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQEFAPVMSTPEVSEDEDRFTDRSK MRAVVLGGVRKTTQ" BASE COUNT 78 a 75 c 66 g 83 t ORIGIN 1 ctctactgct ccaaggtacc ggcgcgaaac gcattgaata gatgtctgag aacctttcac 61 attaggctaa gtacagtaac ttcatatatc caacgcggcc tttgtgaggt ggacaattcg 121 cagttcattg tgttgttttt ctcacgccac caagcaccac cgctctcatt ttggatcgat 181 ctgtgaatct atcctcgtcc tccgacacct cgggagttga cataacaggg gcaaattctt 241 gaaatgcggc ttcgctctca aagttgataa tagcaaatcc gtcataggta aaatcggagg 301 gt // LOCUS aflM_aflN_IC1642 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1642. ACCESSION aflM_aflN_IC1642 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1642" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc // LOCUS aflM_aflN_IC1643 302 bp DNA linear 28-MAY-2013 DEFINITION Aspergillus parasiticus x A. flavus strain IC1643. ACCESSION aflM_aflN_IC1643 VERSION KEYWORDS . SOURCE Aspergillus parasiticus x A. flavus ORGANISM Aspergillus parasiticus x A. flavus Unclassified. REFERENCE 1 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Evidence for recombination, heterosis and toxigenesis in experimental hybrid crosses between Aspergillus flavus and Aspergillus parasiticus JOURNAL Unpublished REFERENCE 2 (bases 1 to 302) AUTHORS Olarte,R.A., Worthington,C.J., Horn,B.W., Monacell,J.T., Moore,G.G., Singh,R., Stone,E.A. and Carbone,I. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Plant Pathology, North Carolina State University, Campus Box 7244 - Partners III Building, Raleigh, NC 27695, USA COMMENT Bankit Comment: TOTAL # OF SEQS:47. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..302 /organism="Aspergillus parasiticus x A. flavus" /mol_type="genomic DNA" /strain="IC1643" /country="USA: Georgia" gene complement(<128..>302) /gene="hypE" mRNA complement(<128..>302) /gene="hypE" /product="hypE" CDS complement(<128..>302) /gene="hypE" /note="hypothetical E protein" /codon_start=2 /product="hypE" /translation="PSDFTYDGFAIINFESEAAFQQFVPVMSTTEVAEDEDRFTDRSK MRAVVLGEVRKTTQ" BASE COUNT 78 a 80 c 61 g 83 t ORIGIN 1 ctctactgct cccaggtagc ggggaaaaag accttgtata tatgcttgaa aacctttcac 61 attacactaa tcacggtaac ttcatatatc caatgcggcc gttgtgaggt ggacaattcg 121 cagttcattg cgtcgttttt ctcacttcac caagcaccac cgctctcatt ttggaccgat 181 ctgtgaatct atcctcgtcc tccgccacct ccgtagtcga cataacaggg acaaattgtt 241 gaaatgcggc ttcgctctca aagtttataa tagcaaaccc gtcataggta aagtcggagg 301 gc //